PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn031311
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 319aa    MW: 36026.4 Da    PI: 5.6187
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn031311genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-163477146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rgr + eE+e +++++  lG++ W++Ia++++ gRt++++k++w++
       Achn031311 34 RGRLSLEEEEAIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNT 77
                     8999******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.391928IPR017877Myb-like domain
SuperFamilySSF466891.5E-191486IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-101442IPR009057Homeodomain-like
PROSITE profilePS5129424.6592983IPR017930Myb domain
SMARTSM007176.5E-153381IPR001005SANT/Myb domain
PfamPF002492.9E-143477IPR001005SANT/Myb domain
CDDcd001679.79E-123879No hitNo description
Gene3DG3DSA:1.10.10.606.4E-204380IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MPTHAQVSVS GRLQRCGKSC RLRWTNYLRP DIKRGRLSLE EEEAIIQLHS ILGNKWSAIA  60
ARLPGRTDNE IKNYWNTNIR KRLLRMGIDP VTHSPRLDLL DLSSILSSSL YNPSQMNLSR  120
LLGFEPLINS EILRLANSLL SSHRENPNFL LQNVQENYLC SPQEVQAQLP QLGQTNQTQT  180
LIQEIPICTT LSTRNCVPFA SEAPLMEPNV DQFSSDFTNF SEWQNKEMPS NLTQDYAQVP  240
NFGYYGSKNS DFQSHNSSNF NFASVLSTPS PSPTPMHSNS GHINSSNTTT TATEDEIESY  300
CSMLKFEIQE MLDVNDFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-20158337105MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-20158337105C-Myb DNA-Binding Domain
1msf_C4e-20158337105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025822.11e-126MYB-like 102
TrEMBLA0A061GMU41e-126A0A061GMU4_THECC; MYB-like 102
STRINGVIT_00s0203g00070.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.15e-73MYB-like 102